Lineage for d4xktd_ (4xkt D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2701406Protein Bacterioferritin (cytochrome b1) [47244] (6 species)
    binds heme between two subunits; 24-mer
  7. 2701458Species Escherichia coli K-12 [TaxId:83333] [188868] (9 PDB entries)
  8. 2701500Domain d4xktd_: 4xkt D: [279951]
    automated match to d3e1ja_
    complexed with so4

Details for d4xktd_

PDB Entry: 4xkt (more details), 1.82 Å

PDB Description: e coli bfr variant y149f
PDB Compounds: (D:) bacterioferritin

SCOPe Domain Sequences for d4xktd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xktd_ a.25.1.1 (D:) Bacterioferritin (cytochrome b1) {Escherichia coli K-12 [TaxId: 83333]}
mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
ieilrdeeghidwleteldliqkmglqnflqaqireeg

SCOPe Domain Coordinates for d4xktd_:

Click to download the PDB-style file with coordinates for d4xktd_.
(The format of our PDB-style files is described here.)

Timeline for d4xktd_: