SCOP 1.67: Domain d1cnb__: 1cnb -

Lineage for d1cnb__ (1cnb -)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (1 family)

5. Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (153 PDB entries)

8. Domain d1cnb__: 1cnb - [27945]
   complexed with seo; mutant

Details for d1cnb__

PDB Entry: 1cnb, 2.35 Å

PDB Description: compensatory plastic effects in the redesign of protein-zinc binding sites

SCOP Domain Sequences for d1cnb__:

Sequence; same for both SEQRES and ATOM records:

>d1cnb__ b.74.1.1 (-) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II}
wgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnngh
afnvefddsqdkavlkggpldgtyrliqfcfhwgsldgqgsehtvdkkkyaaelhlvhwn
tkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgll
pesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdnw
rpaqplknrqikasf

Timeline for d1cnb__:

• d1cnb__ first appeared (with stable ids) in SCOP 1.55
  
• d1cnb__ appears in SCOP 1.65
  
• d1cnb__ appears in SCOP 1.69
  
• d1cnb__ appears in the current release, SCOPe 2.08, called d1cnba_