SCOP 1.67: Domain d12ca__: 12ca -

Lineage for d12ca__ (12ca -)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (1 family)

5. Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (153 PDB entries)

8. Domain d12ca__: 12ca - [27942]
   complexed with hg, zn; mutant

Details for d12ca__

PDB Entry: 12ca, 2.4 Å

PDB Description: altering the mouth of a hydrophobic pocket. structure and kinetics of human carbonic anhydrase ii mutants at residue val-121

SCOP Domain Sequences for d12ca__:

Sequence; same for both SEQRES and ATOM records:

>d12ca__ b.74.1.1 (-) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II}
wgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnngh
afnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlahwn
tkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgll
pesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdnw
rpaqplknrqikasf

Timeline for d12ca__:

• d12ca__ first appeared (with stable ids) in SCOP 1.55
  
• d12ca__ appears in SCOP 1.65
  
• d12ca__ appears in SCOP 1.69
  
• d12ca__ appears in the current release, SCOPe 2.08, called d12caa_