SCOPe 2.07: Domain d4zhra2: 4zhr A:430-553

Lineage for d4zhra2 (4zhr A:430-553)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [225129] (16 PDB entries)

8. Domain d4zhra2: 4zhr A:430-553 [279398]
   Other proteins in same PDB: d4zhra1, d4zhrb_
   automated match to d1bqna1
   mutant

Details for d4zhra2

PDB Entry: 4zhr, 2.6 Å

PDB Description: structure of hiv-1 rt q151m mutant

PDB Compounds: (A:) RT p66 subunit

SCOPe Domain Sequences for d4zhra2:

Sequence; same for both SEQRES and ATOM records:

>d4zhra2 c.55.3.0 (A:430-553) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
ekepiigaetfyvdgaanretklgkagyvtdrgrqkvvpltdttnqktelqaihlalqds
glevnivtdsqyalgiiqaqpdkseselvsqiieqlikkekvylawvpahkgiggneqvd
klvs

Timeline for d4zhra2:

• d4zhra2 first appeared in SCOPe 2.05
  
• d4zhra2 appears in SCOPe 2.06
  
• d4zhra2 appears in the current release, SCOPe 2.08