Lineage for d5byrb2 (5byr B:127-209)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2555939Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2556327Family d.58.1.0: automated matches [229598] (1 protein)
    not a true family
  6. 2556328Protein automated matches [229599] (4 species)
    not a true protein
  7. 2556329Species Clostridium pasteurianum [TaxId:1501] [279205] (17 PDB entries)
  8. 2556339Domain d5byrb2: 5byr B:127-209 [279217]
    Other proteins in same PDB: d5byra1, d5byra3, d5byrb1, d5byrb3
    automated match to d3c8ya3
    complexed with 4ww, fes, gol, mg, sf4

Details for d5byrb2

PDB Entry: 5byr (more details), 1.82 Å

PDB Description: semisynthetic [fefe]-hydrogenase cpi with propane-dithiolato-bridged [2fe] cofactor
PDB Compounds: (B:) Iron hydrogenase 1

SCOPe Domain Sequences for d5byrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5byrb2 d.58.1.0 (B:127-209) automated matches {Clostridium pasteurianum [TaxId: 1501]}
kdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigaedekcfd
dtncllcgqciiacpvaalseks

SCOPe Domain Coordinates for d5byrb2:

Click to download the PDB-style file with coordinates for d5byrb2.
(The format of our PDB-style files is described here.)

Timeline for d5byrb2: