SCOPe 2.07: Domain d4wpva1: 4wpv A:13-244

Lineage for d4wpva1 (4wpv A:13-244)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
   contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain

4. Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families)

5. Family c.109.1.0: automated matches [227144] (1 protein)
   not a true family

6. Protein automated matches [226847] (5 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:419947] [260615] (8 PDB entries)

8. Domain d4wpva1: 4wpv A:13-244 [279021]
   Other proteins in same PDB: d4wpva2
   automated match to d4wiua1
   complexed with gol, po4, zn; mutant

Details for d4wpva1

PDB Entry: 4wpv, 1.67 Å

PDB Description: crystal structure of e83a mutant of mtb pepck in complex with zn2+ and phosphate ion

PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase [GTP]

SCOPe Domain Sequences for d4wpva1:

Sequence; same for both SEQRES and ATOM records:

>d4wpva1 c.109.1.0 (A:13-244) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
ptnhqgllswveevaeltqpdrvvftdgseeefqrlcdqlveagtfirlnpekhknsyla
lsdpsdvarvasrtyicsakeidagptnnwmdpgemrsimkdlyrgcmrgrtmyvvpfcm
gplgaedpklgveitdseyvvvsmrtmtrmgkaalekmgddgffvkalhsvgaplepgqk
dvawpcsetkyithfpetreiwsygsgyggnallgkkcyslriasamahdeg

Timeline for d4wpva1:

• d4wpva1 first appeared in SCOPe 2.05
  
• d4wpva1 appears in SCOPe 2.06
  
• d4wpva1 appears in the current release, SCOPe 2.08