Lineage for d4rzce_ (4rzc E:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2356756Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [331472] (3 PDB entries)
  8. 2356761Domain d4rzce_: 4rzc E: [279012]
    Other proteins in same PDB: d4rzcb_, d4rzcd_, d4rzcf_, d4rzcl_
    automated match to d4kfzc_
    complexed with m6p, so4

Details for d4rzce_

PDB Entry: 4rzc (more details), 2.72 Å

PDB Description: fv m6p-1 in complex with mannose-6-phosphate
PDB Compounds: (E:) Fv M6P-1 light chain

SCOPe Domain Sequences for d4rzce_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rzce_ b.1.1.1 (E:) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
qsvkesegdlvkpgasltltckasgfdftwytmnwvrqapgkglewiasigagvygsnyy
aswakgrftiskassttvtlqmtsltvadtatyfcardginggydiwgpgtlvtvss

SCOPe Domain Coordinates for d4rzce_:

Click to download the PDB-style file with coordinates for d4rzce_.
(The format of our PDB-style files is described here.)

Timeline for d4rzce_: