Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families) has a circularly permuted topology |
Family d.142.2.5: m3G-cap binding domain of snurportin-1 [254171] (2 proteins) |
Protein automated matches [278960] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [278961] (1 PDB entry) |
Domain d5disc2: 5dis C:93-287 [278962] Other proteins in same PDB: d5disb_, d5disc1 automated match to d3gb8b1 complexed with gtp, mal, mg, pro |
PDB Entry: 5dis (more details), 2.85 Å
SCOPe Domain Sequences for d5disc2:
Sequence, based on SEQRES records: (download)
>d5disc2 d.142.2.5 (C:93-287) automated matches {Human (Homo sapiens) [TaxId: 9606]} klpkhyanqlmlsewlidvpsdlgqewivvvcpvgkralivasrgstsaytksgycvnrf ssllpggnrrnstakdytildciynevnqtyyvldvmcwrghpfydcqtdfrfywmhskl peeeglgektklnpfkfvglknfpctpeslcdvlsmdfpfevdgllfyhkqthyspgstp lvgwlrpymvsdvlg
>d5disc2 d.142.2.5 (C:93-287) automated matches {Human (Homo sapiens) [TaxId: 9606]} klpkhyanqlmlsewlidvpsdlgqewivvvcpvgkralivasrgstsaytksgycvnrf ssllpggnrrakdytildciynevnqtyyvldvmcwrghpfydcqtdfrfywmhsklpee eglgektklnpfkfvglknfpctpeslcdvlsmdfpfevdgllfyhkqthyspgstplvg wlrpymvsdvlg
Timeline for d5disc2: