![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
![]() | Superfamily b.74.1: Carbonic anhydrase [51069] (1 family) ![]() |
![]() | Family b.74.1.1: Carbonic anhydrase [51070] (1 protein) |
![]() | Protein Carbonic anhydrase [51071] (10 species) |
![]() | Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (153 PDB entries) |
![]() | Domain d1heb__: 1heb - [27892] complexed with hg, zn; mutant |
PDB Entry: 1heb (more details), 2 Å
SCOP Domain Sequences for d1heb__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1heb__ b.74.1.1 (-) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II} wgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnngh afnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvhwn tkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgll pesldywtypgsettppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdnw rpaqplknrqikasf
Timeline for d1heb__: