Class b: All beta proteins [48724] (141 folds) |
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
Superfamily b.74.1: Carbonic anhydrase [51069] (1 family) |
Family b.74.1.1: Carbonic anhydrase [51070] (1 protein) |
Protein Carbonic anhydrase [51071] (10 species) |
Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (153 PDB entries) |
Domain d1ugc__: 1ugc - [27871] complexed with hg, zn; mutant |
PDB Entry: 1ugc (more details), 2 Å
SCOP Domain Sequences for d1ugc__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ugc__ b.74.1.1 (-) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II} hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn ghhfnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh wntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd nwrpaqplknrqikasfk
Timeline for d1ugc__: