SCOP 1.67: Domain d1uge__: 1uge -

Lineage for d1uge__ (1uge -)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (1 family)

5. Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (153 PDB entries)

8. Domain d1uge__: 1uge - [27865]
   complexed with hg, zn; mutant

Details for d1uge__

PDB Entry: 1uge, 1.9 Å

PDB Description: human carbonic anhydrase ii [hcaii] (e.c.4.2.1.1) mutant with ala 65 replaced by leu (a65l)

SCOP Domain Sequences for d1uge__:

Sequence; same for both SEQRES and ATOM records:

>d1uge__ b.74.1.1 (-) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II}
hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
ghlfnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh
wntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
nwrpaqplknrqikasfk

Timeline for d1uge__:

• d1uge__ first appeared (with stable ids) in SCOP 1.55
  
• d1uge__ appears in SCOP 1.65
  
• d1uge__ appears in SCOP 1.69
  
• d1uge__ appears in the current release, SCOPe 2.08, called d1ugea_