Lineage for d4woza_ (4woz A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2444581Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2444582Protein automated matches [190115] (91 species)
    not a true protein
  7. 2445132Species Peptoclostridium difficile [TaxId:1496] [278431] (1 PDB entry)
  8. 2445133Domain d4woza_: 4woz A: [278441]
    automated match to d2ygya_
    complexed with mn9

Details for d4woza_

PDB Entry: 4woz (more details), 1.96 Å

PDB Description: crystal structures of cdnal from clostridium difficile in complex with mannosamine
PDB Compounds: (A:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d4woza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4woza_ c.1.10.0 (A:) automated matches {Peptoclostridium difficile [TaxId: 1496]}
tdmkgiysallvsfdkegninekglrqiirhnidvckvdglyvggstgenfmlstdekkr
ifeiakdevkeeikliaqvgsvnlkeavelakfttdlgydaisavtpfyykfdfeeikhy
yntiinsvdnrliiysipfltgvdmsldqfgelfenekiigvkftaadfyllermrktfp
nklifagfdemmlpatvlgvdgaigstfnvngvrarqifeltknekisealevqhvtndl
itdilgnglyqtikllleeqgveagycrqpmkeatdemksrakeiyrkyf

SCOPe Domain Coordinates for d4woza_:

Click to download the PDB-style file with coordinates for d4woza_.
(The format of our PDB-style files is described here.)

Timeline for d4woza_: