Lineage for d4w7ua1 (4w7u A:2-312)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2441004Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2441005Protein automated matches [190075] (125 species)
    not a true protein
  7. 2441964Species Xanthomonas axonopodis [TaxId:190486] [260217] (12 PDB entries)
  8. 2441974Domain d4w7ua1: 4w7u A:2-312 [278426]
    Other proteins in same PDB: d4w7ua2
    automated match to d1h1na_
    complexed with cac

Details for d4w7ua1

PDB Entry: 4w7u (more details), 1.48 Å

PDB Description: crystal structure of xaccel5a in the native form
PDB Compounds: (A:) cellulase

SCOPe Domain Sequences for d4w7ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4w7ua1 c.1.8.0 (A:2-312) automated matches {Xanthomonas axonopodis [TaxId: 190486]}
lkyvgvnlsgaefnsrkkpgtlfkdytypaasdfsyfagkgmntirlpflwervqpelng
pldqaqlglikksleaakankqylildlhnyatysgkrigtsdvpagaladlwrrlalef
kddkavifglmnepngisapdwanaaqgtitairktgaknlilvpgtaytgahswrstsy
gvsnakaleilkdpgnnlafeahqyldkdysgtkpvctsdsvgqeklqgftswlrenkqk
gflgefatannpvcdkalegmltymeknsdvwlgwtwwaagawwkpdypftvqpgkdgsd
kpqmailskya

SCOPe Domain Coordinates for d4w7ua1:

Click to download the PDB-style file with coordinates for d4w7ua1.
(The format of our PDB-style files is described here.)

Timeline for d4w7ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4w7ua2