Lineage for d5aure_ (5aur E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304252Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2304253Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2304254Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2304369Protein Cytochrome c552 [46636] (6 species)
  7. 2304370Species Hydrogenobacter thermophilus [TaxId:940] [46640] (9 PDB entries)
  8. 2304374Domain d5aure_: 5aur E: [278300]
    automated match to d1ynra_
    complexed with hec, iod

Details for d5aure_

PDB Entry: 5aur (more details), 1.26 Å

PDB Description: hydrogenobacter thermophilus cytochrome c552 dimer formed by domain swapping at n-terminal region
PDB Compounds: (E:) Cytochrome c-552

SCOPe Domain Sequences for d5aure_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5aure_ a.3.1.1 (E:) Cytochrome c552 {Hydrogenobacter thermophilus [TaxId: 940]}
neqlakqkgcmachdlkagggkkvgpayadvakkyagrkdavdylagkikkggsgvwgsv
pmppqnvtdaeakqlaqwilsik

SCOPe Domain Coordinates for d5aure_:

Click to download the PDB-style file with coordinates for d5aure_.
(The format of our PDB-style files is described here.)

Timeline for d5aure_: