Lineage for d4zylb_ (4zyl B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2463695Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2464082Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2464083Protein automated matches [190131] (84 species)
    not a true protein
  7. 2464375Species Rhodopseudomonas palustris [TaxId:258594] [278269] (1 PDB entry)
  8. 2464377Domain d4zylb_: 4zyl B: [278270]
    automated match to d3heba_

Details for d4zylb_

PDB Entry: 4zyl (more details), 1.8 Å

PDB Description: crystal structure of response regulator rpa3017 in red light signaling of r. palustris
PDB Compounds: (B:) RphyB protein

SCOPe Domain Sequences for d4zylb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zylb_ c.23.1.0 (B:) automated matches {Rhodopseudomonas palustris [TaxId: 258594]}
tlptvlvaedhdydkliltevfarasisadlrfvsdgeqtldyiygrnrfadrgdapypa
ivlldlnmprldgrkvvrllrqdetvrhlvvialstsesakhiteaysigfnaylvkpan
iadyveairslwhfwmntaslptt

SCOPe Domain Coordinates for d4zylb_:

Click to download the PDB-style file with coordinates for d4zylb_.
(The format of our PDB-style files is described here.)

Timeline for d4zylb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4zyla_