Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (84 species) not a true protein |
Species Rhodopseudomonas palustris [TaxId:258594] [278269] (1 PDB entry) |
Domain d4zylb_: 4zyl B: [278270] automated match to d3heba_ |
PDB Entry: 4zyl (more details), 1.8 Å
SCOPe Domain Sequences for d4zylb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zylb_ c.23.1.0 (B:) automated matches {Rhodopseudomonas palustris [TaxId: 258594]} tlptvlvaedhdydkliltevfarasisadlrfvsdgeqtldyiygrnrfadrgdapypa ivlldlnmprldgrkvvrllrqdetvrhlvvialstsesakhiteaysigfnaylvkpan iadyveairslwhfwmntaslptt
Timeline for d4zylb_: