Lineage for d4zl6e_ (4zl6 E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2317148Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2317149Protein automated matches [190036] (58 species)
    not a true protein
  7. 2317801Species Pseudo-nitzschia multiseries [TaxId:37319] [277731] (7 PDB entries)
  8. 2317828Domain d4zl6e_: 4zl6 E: [277763]
    automated match to d1z4aa_
    complexed with fe

Details for d4zl6e_

PDB Entry: 4zl6 (more details), 1.9 Å

PDB Description: crystal structure of the pmftn variant e44h soaked in iron (3 h)
PDB Compounds: (E:) Ferritin

SCOPe Domain Sequences for d4zl6e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zl6e_ a.25.1.0 (E:) automated matches {Pseudo-nitzschia multiseries [TaxId: 37319]}
seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlahsaeerehglgfvdfan
krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
npfhlqqvneedkigsilakvtdenrtpgllrsldvvs

SCOPe Domain Coordinates for d4zl6e_:

Click to download the PDB-style file with coordinates for d4zl6e_.
(The format of our PDB-style files is described here.)

Timeline for d4zl6e_: