SCOPe 2.07: Domain d4zb8a1: 4zb8 A:1-90

Lineage for d4zb8a1 (4zb8 A:1-90)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (188 species)
   not a true protein

7. Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [226685] (10 PDB entries)

8. Domain d4zb8a1: 4zb8 A:1-90 [277705]
   Other proteins in same PDB: d4zb8a2
   automated match to d4ivfa1
   complexed with gds

Details for d4zb8a1

PDB Entry: 4zb8, 2 Å

PDB Description: crystal structure of the glutathione transferase ure2p6 from phanerochaete chrysosporium in complex with oxidized glutathione.

PDB Compounds: (A:) PcUre2p6

SCOPe Domain Sequences for d4zb8a1:

Sequence; same for both SEQRES and ATOM records:

>d4zb8a1 c.47.1.0 (A:1-90) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
mshgkqftlythkggpngwkvtivleelgltyesifldfqkgehkapeylkvnpngripa
lidhknndytvwesnaiiqylvdkydkdrk

Timeline for d4zb8a1:

• d4zb8a1 first appeared in SCOPe 2.05
  
• d4zb8a1 appears in SCOPe 2.06
  
• d4zb8a1 appears in the current release, SCOPe 2.08