Lineage for d4zbac1 (4zba C:2-95)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486890Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2486891Protein automated matches [190056] (188 species)
    not a true protein
  7. 2487094Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [226685] (10 PDB entries)
  8. 2487101Domain d4zbac1: 4zba C:2-95 [277694]
    Other proteins in same PDB: d4zbaa2, d4zbab2, d4zbac2, d4zbad2
    automated match to d1k0ba2
    complexed with act, cl, gds

Details for d4zbac1

PDB Entry: 4zba (more details), 1.5 Å

PDB Description: crystal structure of the glutathione transferase ure2p8 from phanerochaete chrysosporium with oxidized glutathione.
PDB Compounds: (C:) PcUre2p8

SCOPe Domain Sequences for d4zbac1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zbac1 c.47.1.0 (C:2-95) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
ashdkqfslflhkasahgwkvafvleelslsyeivlvdvakneqkspefmklnpngrtpa
lidhgnsdfviwesnamvqyvadkydterkisma

SCOPe Domain Coordinates for d4zbac1:

Click to download the PDB-style file with coordinates for d4zbac1.
(The format of our PDB-style files is described here.)

Timeline for d4zbac1: