Lineage for d1ppi_1 (1ppi 404-496)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 380059Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 380060Superfamily b.71.1: Glycosyl hydrolase domain [51011] (3 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 380061Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 380089Protein Animal alpha-amylase [51024] (3 species)
  7. 380111Species Pig (Sus scrofa) [TaxId:9823] [51025] (12 PDB entries)
  8. 380129Domain d1ppi_1: 1ppi 404-496 [27763]
    Other proteins in same PDB: d1ppi_2
    complexed with ca, cl, daf, glc

Details for d1ppi_1

PDB Entry: 1ppi (more details), 2.2 Å

PDB Description: the active center of a mammalian alpha-amylase. the structure of the complex of a pancreatic alpha-amylase with a carbohydrate inhibitor refined to 2.2 angstroms resolution

SCOP Domain Sequences for d1ppi_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ppi_1 b.71.1.1 (404-496) Animal alpha-amylase {Pig (Sus scrofa)}
epfanwwdngsnqvafgrgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsct
gikvyvssdgtaqfsisnsaedpfiaihaeskl

SCOP Domain Coordinates for d1ppi_1:

Click to download the PDB-style file with coordinates for d1ppi_1.
(The format of our PDB-style files is described here.)

Timeline for d1ppi_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ppi_2