SCOP 1.71: Domain d1a47_3: 1a47 407-495

Lineage for d1a47_3 (1a47 407-495)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Cyclodextrin glycosyltransferase [51018] (5 species)
   contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like

7. Species Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId:33950] [51023] (2 PDB entries)

8. Domain d1a47_3: 1a47 407-495 [27760]
   Other proteins in same PDB: d1a47_1, d1a47_2, d1a47_4
   complexed with ca, cyl, glc, gld, gte

Details for d1a47_3

PDB Entry: 1a47, 2.56 Å

PDB Description: cgtase from thermoanaerobacterium thermosulfurigenes em1 in complex with a maltohexaose inhibitor

SCOP Domain Sequences for d1a47_3:

Sequence; same for both SEQRES and ATOM records:

>d1a47_3 b.71.1.1 (407-495) Cyclodextrin glycosyltransferase {Thermoanaerobacterium thermosulfurigenes, EM1}
gttqqrwinndvyiyerkfgnnvalvainrnlstsynitglytalpagtytdvlggllng
nsisvasdgsvtpftlsagevavwqyvss

Timeline for d1a47_3:

• d1a47_3 first appeared (with stable ids) in SCOP 1.55
  
• d1a47_3 appears in SCOP 1.69
  
• d1a47_3 is called d1a47a3 in SCOP 1.73
  
• d1a47_3 appears in the current release, SCOPe 2.08, called d1a47a3