![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins) this domain follows the catalytic beta/alpha barrel domain |
![]() | Protein Cyclodextrin glycosyltransferase [51018] (5 species) contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like |
![]() | Species Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId:33950] [51023] (2 PDB entries) |
![]() | Domain d1a47a3: 1a47 A:407-495 [27760] Other proteins in same PDB: d1a47a1, d1a47a2, d1a47a4 complexed with ca, cyl, glc, gld, gte |
PDB Entry: 1a47 (more details), 2.56 Å
SCOP Domain Sequences for d1a47a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a47a3 b.71.1.1 (A:407-495) Cyclodextrin glycosyltransferase {Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId: 33950]} gttqqrwinndvyiyerkfgnnvalvainrnlstsynitglytalpagtytdvlggllng nsisvasdgsvtpftlsagevavwqyvss
Timeline for d1a47a3: