Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) |
Family d.104.1.0: automated matches [227172] (1 protein) not a true family |
Protein automated matches [226887] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225403] (12 PDB entries) |
Domain d4ttvb1: 4ttv B:322-611 [277574] Other proteins in same PDB: d4ttva2, d4ttva3, d4ttvb2, d4ttvb3, d4ttvc2, d4ttvc3, d4ttvd2, d4ttvd3 automated match to d4hwra1 protein/RNA complex; complexed with bc9, zn |
PDB Entry: 4ttv (more details), 2.8 Å
SCOPe Domain Sequences for d4ttvb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ttvb1 d.104.1.0 (B:322-611) automated matches {Human (Homo sapiens) [TaxId: 9606]} dhrkigrdqelyffhelspgscfflpkgayiynaliefirseyrkrgfqevvtpnifnsr lwmtsghwqhysenmfsfevekelfalkpmncpghclmfdhrprswrelplrladfgvlh rnelsgaltgltrvrrfqqddahifcameqiedeikgcldflrtvysvfgfsfklnlstr pekflgdievwdqaekqlenslnefgekwelnsgdgafygpkidiqikdaigryhqcati qldfqlpirfnltyvshdgddkkrpvivhrailgsvermiailtenyggk
Timeline for d4ttvb1: