![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
![]() | Protein Cyclodextrin glycosyltransferase [51018] (5 species) contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like |
![]() | Species Bacillus sp., strain 1011 [TaxId:1409] [51022] (8 PDB entries) Uniprot P05618 |
![]() | Domain d1deda3: 1ded A:407-496 [27757] Other proteins in same PDB: d1deda1, d1deda2, d1deda4, d1dedb1, d1dedb2, d1dedb4 complexed with ca has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1ded (more details), 2 Å
SCOPe Domain Sequences for d1deda3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1deda3 b.71.1.1 (A:407-496) Cyclodextrin glycosyltransferase {Bacillus sp., strain 1011 [TaxId: 1409]} gstherwinndviiyerkfgnnvavvainrnmntpasitglvtslprgsyndvlggilng ntltvgaggaasnftlapggtavwqyttda
Timeline for d1deda3:
![]() Domains from other chains: (mouse over for more information) d1dedb1, d1dedb2, d1dedb3, d1dedb4 |