Lineage for d1qhpa3 (1qhp A:408-495)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810333Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2810494Protein Cyclodextrin glycosyltransferase [51018] (5 species)
    contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like
  7. 2810555Species Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId:1422] [51021] (2 PDB entries)
  8. 2810556Domain d1qhpa3: 1qhp A:408-495 [27752]
    Other proteins in same PDB: d1qhpa1, d1qhpa2, d1qhpa4
    complexed with ca, so4
    has additional insertions and/or extensions that are not grouped together

Details for d1qhpa3

PDB Entry: 1qhp (more details), 1.7 Å

PDB Description: five-domain alpha-amylase from bacillus stearothermophilus, maltose complex
PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d1qhpa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qhpa3 b.71.1.1 (A:408-495) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]}
gtttqrwinndvyiyerkffndvvlvainrntqssysisglqtalpngsyadylsgllgg
ngisvsngsvasftlapgavsvwqysts

SCOPe Domain Coordinates for d1qhpa3:

Click to download the PDB-style file with coordinates for d1qhpa3.
(The format of our PDB-style files is described here.)

Timeline for d1qhpa3: