Lineage for d1eo7a3 (1eo7 A:407-496)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810333Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2810494Protein Cyclodextrin glycosyltransferase [51018] (5 species)
    contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like
  7. 2810495Species Bacillus circulans, different strains [TaxId:1397] [51019] (36 PDB entries)
  8. 2810531Domain d1eo7a3: 1eo7 A:407-496 [27749]
    Other proteins in same PDB: d1eo7a1, d1eo7a2, d1eo7a4
    complexed with ca
    has additional insertions and/or extensions that are not grouped together

Details for d1eo7a3

PDB Entry: 1eo7 (more details), 2.48 Å

PDB Description: bacillus circulans strain 251 cyclodextrin glycosyltransferase in complex with maltohexaose
PDB Compounds: (A:) protein (cyclodextrin glycosyltransferase)

SCOPe Domain Sequences for d1eo7a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eo7a3 b.71.1.1 (A:407-496) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains [TaxId: 1397]}
gstqerwinndvliyerkfgsnvavvavnrnlnapasisglvtslpqgsyndvlggllng
ntlsvgsggaasnftlaaggtavwqytaat

SCOPe Domain Coordinates for d1eo7a3:

Click to download the PDB-style file with coordinates for d1eo7a3.
(The format of our PDB-style files is described here.)

Timeline for d1eo7a3: