Class b: All beta proteins [48724] (126 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (2 families) |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (19 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Cyclodextrin glycosyltransferase [51018] (5 species) contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like |
Species Bacillus circulans, different strains [TaxId:1397] [51019] (31 PDB entries) |
Domain d1cxf_3: 1cxf 407-495 [27748] Other proteins in same PDB: d1cxf_1, d1cxf_2, d1cxf_4 complexed with acx, ca, glc, mal; mutant |
PDB Entry: 1cxf (more details), 2.6 Å
SCOP Domain Sequences for d1cxf_3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cxf_3 b.71.1.1 (407-495) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains} gstqerwinndvliyerkfgsnvavvavnrnlnapasisglvtslpqgsyndvlggllng ntlsvgsggaasnftlaaggtavwqytaa
Timeline for d1cxf_3: