Lineage for d5anmf1 (5anm F:335-438)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2361253Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
  8. 2363359Domain d5anmf1: 5anm F:335-438 [277472]
    Other proteins in same PDB: d5anma1, d5anmc1, d5anml1
    automated match to d1f6ab1

Details for d5anmf1

PDB Entry: 5anm (more details), 2.85 Å

PDB Description: crystal structure of ige fc in complex with a neutralizing antibody
PDB Compounds: (F:) ig epsilon chain c region

SCOPe Domain Sequences for d5anmf1:

Sequence, based on SEQRES records: (download)

>d5anmf1 b.1.1.2 (F:335-438) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvsaylsrpspfdlfirksptitclvvdlapskgtvnltwsrasgkpvnhstrkeekqrn
gtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsg

Sequence, based on observed residues (ATOM records): (download)

>d5anmf1 b.1.1.2 (F:335-438) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvsaylsrpspfdlfirksptitclvvdlapskgtvnltwsrasgkpvnhstrkeekqrn
gtltvtstlpvgtrdwiegetyqcrvthppralmrsttktsg

SCOPe Domain Coordinates for d5anmf1:

Click to download the PDB-style file with coordinates for d5anmf1.
(The format of our PDB-style files is described here.)

Timeline for d5anmf1: