SCOPe 2.08: Domain d1dtua3: 1dtu A:407-496

Lineage for d1dtua3 (1dtu A:407-496)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Cyclodextrin glycosyltransferase [51018] (5 species)
   contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like

7. Species Bacillus circulans, different strains [TaxId:1397] [51019] (36 PDB entries)

8. Domain d1dtua3: 1dtu A:407-496 [27747]
   Other proteins in same PDB: d1dtua1, d1dtua2, d1dtua4
   complexed with adh, ca; mutant
   has additional insertions and/or extensions that are not grouped together

Details for d1dtua3

PDB Entry: 1dtu, 2.4 Å

PDB Description: bacillus circulans strain 251 cyclodextrin glycosyltransferase: a mutant y89d/s146p complexed to an hexasaccharide inhibitor

PDB Compounds: (A:) protein (cyclodextrin glycosyltransferase)

SCOPe Domain Sequences for d1dtua3:

Sequence; same for both SEQRES and ATOM records:

>d1dtua3 b.71.1.1 (A:407-496) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains [TaxId: 1397]}
gstqerwinndvliyerkfgsnvavvavnrnlnapasisglvtslpqgsyndvlggllng
ntlsvgsggaasnftlaaggtavwqytaat

Timeline for d1dtua3:

• d1dtua3 first appeared (with stable ids) in SCOP 1.55
  
• d1dtua3 appears in SCOPe 2.07