Lineage for d1cxia3 (1cxi A:407-495)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1555652Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1555653Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1555654Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 1555802Protein Cyclodextrin glycosyltransferase [51018] (5 species)
    contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like
  7. 1555803Species Bacillus circulans, different strains [TaxId:1397] [51019] (36 PDB entries)
  8. 1555822Domain d1cxia3: 1cxi A:407-495 [27725]
    Other proteins in same PDB: d1cxia1, d1cxia2, d1cxia4
    complexed with ca, mal

Details for d1cxia3

PDB Entry: 1cxi (more details), 2.2 Å

PDB Description: wild-type cgtase from bacillus circulans strain 251 at 120 k and ph 7.55
PDB Compounds: (A:) cyclodextrin glycosyltransferase

SCOPe Domain Sequences for d1cxia3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cxia3 b.71.1.1 (A:407-495) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains [TaxId: 1397]}
gstqerwinndvliyerkfgsnvavvavnrnlnapasisglvtslpqgsyndvlggllng
ntlsvgsggaasnftlaaggtavwqytaa

SCOPe Domain Coordinates for d1cxia3:

Click to download the PDB-style file with coordinates for d1cxia3.
(The format of our PDB-style files is described here.)

Timeline for d1cxia3: