Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein automated matches [190041] (34 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:287] [189215] (23 PDB entries) |
Domain d5d8xq_: 5d8x Q: [277225] automated match to d4e6ka_ complexed with hem, k, mpd, mrd, na |
PDB Entry: 5d8x (more details), 1.5 Å
SCOPe Domain Sequences for d5d8xq_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d8xq_ a.25.1.1 (Q:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll kdileseeehidyletqlgliqkvglenylqshmhe
Timeline for d5d8xq_: