SCOP 1.63: Domain d1aqh_1: 1aqh 355-448

Lineage for d1aqh_1 (1aqh 355-448)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family)

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (18 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Bacterial alpha-Amylase [51013] (4 species)

7. Species Pseudoalteromonas haloplanctis (Alteromonas haloplanctis) [51015] (9 PDB entries)

8. Domain d1aqh_1: 1aqh 355-448 [27718]
   Other proteins in same PDB: d1aqh_2
   complexed with ca, cl

Details for d1aqh_1

PDB Entry: 1aqh, 2 Å

PDB Description: alpha-amylase from alteromonas haloplanctis

SCOP Domain Sequences for d1aqh_1:

Sequence; same for both SEQRES and ATOM records:

>d1aqh_1 b.71.1.1 (355-448) Bacterial alpha-Amylase {Pseudoalteromonas haloplanctis (Alteromonas haloplanctis)}
nwavtnwwdntnnqisfgrgssghmainkedstltatvqtdmasgqycnvlkgelsadak
scsgevitvnsdgtinlnigawdamaihknakln

Timeline for d1aqh_1:

• d1aqh_1 first appeared (with stable ids) in SCOP 1.55
  
• d1aqh_1 appears in SCOP 1.61
  
• d1aqh_1 appears in SCOP 1.65
  
• d1aqh_1 appears in the current release, SCOPe 2.08, called d1aqha1