Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (81 species) not a true protein |
Species Trypanosoma cruzi [TaxId:353153] [188400] (13 PDB entries) |
Domain d4yv0c_: 4yv0 C: [277044] automated match to d2o06a_ complexed with 4jw, s4m |
PDB Entry: 4yv0 (more details), 1.95 Å
SCOPe Domain Sequences for d4yv0c_:
Sequence, based on SEQRES records: (download)
>d4yv0c_ c.66.1.0 (C:) automated matches {Trypanosoma cruzi [TaxId: 353153]} isggwfreendqwpgqamslrvekvlydaptkfqhltifesdpkgpwgtvmaldgciqvt dydefvyhevlghtslcshpkpervliigggdggvlrevlrhgtvehcdlvdidgevmeq skqhfpqisrsladpratvrvgdglafvrqtpdntydvviidttdpagpasklfgeafyk dvlrilkpdgiccnqgesiwldleliekmsrfiretgfasvqyalmhvptypcgsigtlv cskkagvdvtkplrpvedmpfakdlkyydsemhkasfalprfarhinn
>d4yv0c_ c.66.1.0 (C:) automated matches {Trypanosoma cruzi [TaxId: 353153]} isggwfreepgqamslrvekvlydaptkfqhltifesdpkgpwgtvmaldgciqvtdyde fvyhevlghtslcshpkpervliigggdggvlrevlrhgtvehcdlvdidgevmeqskqh fpqisrsladpratvrvgdglafvrqtpdntydvviidtteafykdvlrilkpdgiccnq gesiwldleliekmsrfiretgfasvqyalmhvptypcgsigtlvcskkagvdvtkplrp vedmpfakdlkyydsemhkasfalprfarhinn
Timeline for d4yv0c_: