Lineage for d2bbkj_ (2bbk J:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17159Fold b.69: 7-bladed beta-propeller [50964] (7 superfamilies)
  4. 17167Superfamily b.69.2: Methylamine dehydrogenase, H-chain [50969] (1 family) (S)
  5. 17168Family b.69.2.1: Methylamine dehydrogenase, H-chain [50970] (1 protein)
    this is a repeat family; one repeat unit is 1mg2 A:132-178 found in domain
  6. 17169Protein Methylamine dehydrogenase, H-chain [50971] (2 species)
  7. 17174Species Paracoccus denitrificans [TaxId:266] [50972] (3 PDB entries)
  8. 17176Domain d2bbkj_: 2bbk J: [27635]
    Other proteins in same PDB: d2bbkl_, d2bbkm_

Details for d2bbkj_

PDB Entry: 2bbk (more details), 1.75 Å

PDB Description: crystal structure of the quinoprotein methylamine dehydrogenase from paracoccus denitrificans at 1.75 angstroms

SCOP Domain Sequences for d2bbkj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bbkj_ b.69.2.1 (J:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans}
deprileapapdarrvyvndpahfaavtqqfvidgeagrvigmidggflpnpvvaddgsf
iahastvfsriargertdyvevfdpvtllptadielpdaprflvgtypwmtsltpdgktl
lfyqfspapavgvvdlegkafkrmldvpdcyhifptapdtffmhcrdgslakvafgtegt
peithtevfhpedeflinhpaysqkagrlvwptytgkihqidlssgdakflpavealtea
eradgwrpggwqqvayhraldriyllvdqrdewrhktasrfvvvldaktgerlakfemgh
eidsinvsqdekpllyalstgdktlyihdaesgeelrsvnqlghgpqvittadmg

SCOP Domain Coordinates for d2bbkj_:

Click to download the PDB-style file with coordinates for d2bbkj_.
(The format of our PDB-style files is described here.)

Timeline for d2bbkj_: