Lineage for d2bbkj_ (2bbk J:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2808749Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (4 families) (S)
  5. 2808750Family b.69.2.1: Methylamine dehydrogenase, H-chain [50970] (1 protein)
    less regular propeller without notable sequence repeats; quinone cofactor is a tryptophan derivative in another subunit
    automatically mapped to Pfam PF06433

    this is a repeat family; one repeat unit is 1mg2 A:132-178 found in domain
  6. 2808751Protein Methylamine dehydrogenase, H-chain [50971] (2 species)
  7. 2808752Species Paracoccus denitrificans [TaxId:266] [50972] (5 PDB entries)
  8. 2808754Domain d2bbkj_: 2bbk J: [27635]
    Other proteins in same PDB: d2bbkl_, d2bbkm_
    missing some secondary structures that made up less than one-third of the common domain

Details for d2bbkj_

PDB Entry: 2bbk (more details), 1.75 Å

PDB Description: crystal structure of the quinoprotein methylamine dehydrogenase from paracoccus denitrificans at 1.75 angstroms
PDB Compounds: (J:) methylamine dehydrogenase (heavy subunit)

SCOPe Domain Sequences for d2bbkj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bbkj_ b.69.2.1 (J:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}
deprileapapdarrvyvndpahfaavtqqfvidgeagrvigmidggflpnpvvaddgsf
iahastvfsriargertdyvevfdpvtllptadielpdaprflvgtypwmtsltpdgktl
lfyqfspapavgvvdlegkafkrmldvpdcyhifptapdtffmhcrdgslakvafgtegt
peithtevfhpedeflinhpaysqkagrlvwptytgkihqidlssgdakflpavealtea
eradgwrpggwqqvayhraldriyllvdqrdewrhktasrfvvvldaktgerlakfemgh
eidsinvsqdekpllyalstgdktlyihdaesgeelrsvnqlghgpqvittadmg

SCOPe Domain Coordinates for d2bbkj_:

Click to download the PDB-style file with coordinates for d2bbkj_.
(The format of our PDB-style files is described here.)

Timeline for d2bbkj_: