Lineage for d1gog_3 (1gog 151-537)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.69: 7-bladed beta-propeller [50964] (7 superfamilies) 
Superfamily b.69.1: Galactose oxidase, central domain [50965] (1 family) 
Family b.69.1.1: Galactose oxidase, central domain [50966] (1 protein) Protein Galactose oxidase, central domain [50967] (1 species) Species Dactylium dendroides [TaxId:5132] [50968] (3 PDB entries) 
Domain d1gog_3: 1gog 151-537 [27632]
Other proteins in same PDB: d1gog_1, d1gog_2
Details for d1gog_3
PDB Entry: 1gog (more details), 1.9 Å
PDB Description: novel thioether bond revealed by a 1.7 angstroms crystal structure of galactose oxidase
SCOP Domain Sequences for d1gog_3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gog_3 b.69.1.1 (151-537) Galactose oxidase, central domain {Dactylium dendroides}
ytapqpglgrwgptidlpivpaaaaieptsgrvlmwssyrndafggspggitltsswdps
tgivsdrtvtvtkhdmfcpgismdgngqivvtggndakktslydsssdswipgpdmqvar
gyqssatmsdgrvftiggswsggvfekngevyspssktwtslpnakvnpmltadkqglyr
sdnhawlfgwkkgsvfqagpstamnwyytsgsgdvksagkrqsnrgvapdamcgnavmyd
avkgkiltfggspdyqdsdattnahiitlgepgtspntvfasnglyfartfhtsvvlpdg
stfitggqrrgipfedstpvftpeiyvpeqdtfykqnpnsivrvyhsislllpdgrvfng
ggglcgdcttnhfdaqiftpnylynsn
SCOP Domain Coordinates for d1gog_3:
Click to download the PDB-style file with coordinates for d1gog_3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gog_3:
- d1gog_3 appears in SCOP 1.57
- d1gog_3 appears in the current release, SCOPe 2.08, called d1goga3
View in 3D
