Lineage for d1gog_3 (1gog 151-537)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 62854Fold b.69: 7-bladed beta-propeller [50964] (7 superfamilies)
  4. 62855Superfamily b.69.1: Galactose oxidase, central domain [50965] (1 family) (S)
  5. 62856Family b.69.1.1: Galactose oxidase, central domain [50966] (1 protein)
  6. 62857Protein Galactose oxidase, central domain [50967] (1 species)
  7. 62858Species Dactylium dendroides [TaxId:5132] [50968] (3 PDB entries)
  8. 62860Domain d1gog_3: 1gog 151-537 [27632]
    Other proteins in same PDB: d1gog_1, d1gog_2

Details for d1gog_3

PDB Entry: 1gog (more details), 1.9 Å

PDB Description: novel thioether bond revealed by a 1.7 angstroms crystal structure of galactose oxidase

SCOP Domain Sequences for d1gog_3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gog_3 b.69.1.1 (151-537) Galactose oxidase, central domain {Dactylium dendroides}
ytapqpglgrwgptidlpivpaaaaieptsgrvlmwssyrndafggspggitltsswdps
tgivsdrtvtvtkhdmfcpgismdgngqivvtggndakktslydsssdswipgpdmqvar
gyqssatmsdgrvftiggswsggvfekngevyspssktwtslpnakvnpmltadkqglyr
sdnhawlfgwkkgsvfqagpstamnwyytsgsgdvksagkrqsnrgvapdamcgnavmyd
avkgkiltfggspdyqdsdattnahiitlgepgtspntvfasnglyfartfhtsvvlpdg
stfitggqrrgipfedstpvftpeiyvpeqdtfykqnpnsivrvyhsislllpdgrvfng
ggglcgdcttnhfdaqiftpnylynsn

SCOP Domain Coordinates for d1gog_3:

Click to download the PDB-style file with coordinates for d1gog_3.
(The format of our PDB-style files is described here.)

Timeline for d1gog_3: