Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.18: Subunit IX of photosystem I reaction centre, PsaJ [81544] (2 families) automatically mapped to Pfam PF01701 |
Family f.23.18.0: automated matches [276196] (1 protein) not a true family |
Protein automated matches [276198] (4 species) not a true protein |
Species Pea (Pisum sativum) [TaxId:3888] [276201] (7 PDB entries) |
Domain d4y28j_: 4y28 J: [276204] Other proteins in same PDB: d4y281_, d4y282_, d4y283_, d4y284_, d4y28a_, d4y28b_, d4y28c_, d4y28d_, d4y28e_, d4y28f_ automated match to d1jb0j_ complexed with bcr, ca, chl, cl0, cla, dgd, lhg, lmg, lmu, lut, pqn, sf4, zex |
PDB Entry: 4y28 (more details), 2.8 Å
SCOPe Domain Sequences for d4y28j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y28j_ f.23.18.0 (J:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} rdlktylsvapvastlwfaalagllieinrlfpdaltfpff
Timeline for d4y28j_: