SCOPe 2.07: Domain d4x24b1: 4x24 B:1-231

Lineage for d4x24b1 (4x24 B:1-231)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.0: automated matches [191488] (1 protein)
   not a true family

6. Protein automated matches [190781] (45 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:345073] [276178] (2 PDB entries)

8. Domain d4x24b1: 4x24 B:1-231 [276188]
   Other proteins in same PDB: d4x24a2, d4x24b2
   automated match to d4qezb_
   complexed with pge, tdi

Details for d4x24b1

PDB Entry: 4x24, 1.5 Å

PDB Description: crystal structure of vibrio cholerae 5'-methylthioadenosine/s-adenosyl homocysteine nucleosidase (mtan) complexed with methylthio-dadme- immucillin-a

PDB Compounds: (B:) 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

SCOPe Domain Sequences for d4x24b1:

Sequence; same for both SEQRES and ATOM records:

>d4x24b1 c.56.2.0 (B:1-231) automated matches {Vibrio cholerae [TaxId: 345073]}
mkigiigamqqevailkdliedvqevnqagctfysgqiqgvdvvllqsgigkvsaalgta
llisqyapdvvintgsaggfdaslnvgdvvissevrhhdadvtafgyeigqmpgqpaafk
adeklmtvaeqalaqlpnthavrglictgdafictaegqqfirqhfpsvvavemeasaia
qtchqfkvpfvvvraisdvadkesplsfeeflplaaksssamvlkmvellk

Timeline for d4x24b1:

• d4x24b1 first appeared in SCOPe 2.05, called d4x24b_
  
• d4x24b1 appears in SCOPe 2.06
  
• d4x24b1 appears in the current release, SCOPe 2.08