SCOPe 2.07: Domain d4zzzb2: 4zzz B:797-1011

Lineage for d4zzzb2 (4zzz B:797-1011)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.0: automated matches [191650] (1 protein)
   not a true family

6. Protein automated matches [191197] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225406] (55 PDB entries)

8. Domain d4zzzb2: 4zzz B:797-1011 [276098]
   Other proteins in same PDB: d4zzzb1
   automated match to d4gv2a2
   complexed with fsu, gol, so4

Details for d4zzzb2

PDB Entry: 4zzz, 1.9 Å

PDB Description: structure of human parp1 catalytic domain bound to an isoindolinone inhibitor

PDB Compounds: (B:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d4zzzb2:

Sequence; same for both SEQRES and ATOM records:

>d4zzzb2 d.166.1.0 (B:797-1011) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnfkt

Timeline for d4zzzb2:

• d4zzzb2 first appeared in SCOPe 2.05
  
• d4zzzb2 appears in SCOPe 2.06
  
• d4zzzb2 appears in the current release, SCOPe 2.08