Lineage for d4yvha1 (4yvh A:1-246)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2528466Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 2528467Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 2528542Family c.116.1.4: tRNA(m1G37)-methyltransferase TrmD [89629] (2 proteins)
    fold and dimerisation mode are similar to those of the YbeA-like family; contains additional C-terminal all-alpha subdomain
  6. 2528555Protein automated matches [196235] (4 species)
    not a true protein
  7. 2528556Species Haemophilus influenzae [TaxId:71421] [196236] (37 PDB entries)
  8. 2528566Domain d4yvha1: 4yvh A:1-246 [275100]
    Other proteins in same PDB: d4yvha2
    automated match to d1uaja_
    complexed with sfg

Details for d4yvha1

PDB Entry: 4yvh (more details), 1.6 Å

PDB Description: crystal structure of h. influenzae trmd in complex with sinefungin
PDB Compounds: (A:) tRNA (guanine-N(1)-)-methyltransferase

SCOPe Domain Sequences for d4yvha1:

Sequence, based on SEQRES records: (download)

>d4yvha1 c.116.1.4 (A:1-246) automated matches {Haemophilus influenzae [TaxId: 71421]}
mwigvislfpemfkaitefgvtgravkhnllkvecwnprdftfdkhktvddrpygggpgm
lmmvqplrdaihtakaaagegakviylspqgrkldqggvtelaqnqklilvcgryegide
rliqteideewsigdyvltggelpamtlidavarfipgvlgkqasaeedsfadglldcph
ytrpevlegltvppvlmsghheeirkwrlkqslqrtwlrrpelleglaltdeqrkllkea
qaehns

Sequence, based on observed residues (ATOM records): (download)

>d4yvha1 c.116.1.4 (A:1-246) automated matches {Haemophilus influenzae [TaxId: 71421]}
mwigvislfpemfkaitefgvtgravkhnllkvecwnprdftfdkhktvddrpygggpgm
lmmvqplrdaihtakaaagegakviylspqgrkldqggvtelaqnqklilvcgryegide
rliqteideewsigdyvltggelpamtlidavarfipgvldsfadglldcphytrpevle
gltvppvlmsghheeirkwrlkqslqrtwlrrpelleglaltdeqrkllkeaqaehns

SCOPe Domain Coordinates for d4yvha1:

Click to download the PDB-style file with coordinates for d4yvha1.
(The format of our PDB-style files is described here.)

Timeline for d4yvha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4yvha2