Lineage for d1awtc_ (1awt C:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 379249Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 379250Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family) (S)
  5. 379251Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)
  6. 379258Protein Cyclophilin (eukaryotic) [50893] (9 species)
  7. 379271Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (42 PDB entries)
  8. 379356Domain d1awtc_: 1awt C: [27483]

Details for d1awtc_

PDB Entry: 1awt (more details), 2.55 Å

PDB Description: secypa complexed with hagpia

SCOP Domain Sequences for d1awtc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1awtc_ b.62.1.1 (C:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A}
vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOP Domain Coordinates for d1awtc_:

Click to download the PDB-style file with coordinates for d1awtc_.
(The format of our PDB-style files is described here.)

Timeline for d1awtc_: