SCOPe 2.07: Domain d5akra1: 5akr A:4-166

Lineage for d5akra1 (5akr A:4-166)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (29 species)
   not a true protein

7. Species Achromobacter cycloclastes [TaxId:223] [225121] (13 PDB entries)

8. Domain d5akra1: 5akr A:4-166 [274676]
   Other proteins in same PDB: d5akra2
   automated match to d1kcba1
   complexed with act, cu, mli, no2, so4

Details for d5akra1

PDB Entry: 5akr, 0.87 Å

PDB Description: atomic resolution structure of nitrite bound state of the achromobacter cycloclastes cu nitrite reductase at 0.87 a resolution

PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d5akra1:

Sequence; same for both SEQRES and ATOM records:

>d5akra1 b.6.1.0 (A:4-166) automated matches {Achromobacter cycloclastes [TaxId: 223]}
aapvdistlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamt
fngsvpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlr
fkatkpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdek

Timeline for d5akra1:

• d5akra1 first appeared in SCOPe 2.05
  
• d5akra1 appears in SCOPe 2.06
  
• d5akra1 appears in the current release, SCOPe 2.08