Lineage for d4zakd1 (4zak D:2-112)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757148Domain d4zakd1: 4zak D:2-112 [274611]
    Other proteins in same PDB: d4zaka1, d4zakb_, d4zakc2
    automated match to d3q5ya1
    complexed with 4lx, nag

Details for d4zakd1

PDB Entry: 4zak (more details), 2.82 Å

PDB Description: crystal structure of the mcd1d/db06-1/inktcr ternary complex
PDB Compounds: (D:) T cell antigen receptor beta chain 8.2,T-cell receptor beta-2 chain C region,Protein Trbc2,T-cell receptor beta-2 chain C region

SCOPe Domain Sequences for d4zakd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zakd1 b.1.1.0 (D:2-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdip
dgykasrpsqenfslilelatpsqtsvyfcasgdegytqyfgpgtrllvle

SCOPe Domain Coordinates for d4zakd1:

Click to download the PDB-style file with coordinates for d4zakd1.
(The format of our PDB-style files is described here.)

Timeline for d4zakd1: