Lineage for d4z76d1 (4z76 D:0-181)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2544723Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2545171Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (52 PDB entries)
    Uniprot P01901 22-299
  8. 2545205Domain d4z76d1: 4z76 D:0-181 [274394]
    Other proteins in same PDB: d4z76a2, d4z76a3, d4z76b1, d4z76b2, d4z76d2, d4z76d3, d4z76e1, d4z76e2
    automated match to d1kj3h2
    complexed with edo, gol, so4

Details for d4z76d1

PDB Entry: 4z76 (more details), 1.88 Å

PDB Description: weak tcr binding to an unstable insulin epitope drives type 1 diabetes
PDB Compounds: (D:) H-2 class I histocompatibility antigen, K-D alpha chain

SCOPe Domain Sequences for d4z76d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z76d1 d.19.1.1 (D:0-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
mgphslryfvtavsrpglgeprfiavgyvddtqfvrfdsdadnprfeprapwmeqegpey
weeqtqraksdeqwfrvslrtaqryynqskggshtfqrmfgcdvgsdwrllrgyhqfayd
grdyialnedlktwtaadtaalitrrkweqagdaeyyraylegecvewlrrylelgnetl
lr

SCOPe Domain Coordinates for d4z76d1:

Click to download the PDB-style file with coordinates for d4z76d1.
(The format of our PDB-style files is described here.)

Timeline for d4z76d1: