Class b: All beta proteins [48724] (165 folds) |
Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (3 families) |
Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (12 proteins) |
Protein Cyclophilin (eukaryotic) [50893] (13 species) |
Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (48 PDB entries) |
Domain d1cwaa_: 1cwa A: [27434] complexed with aba |
PDB Entry: 1cwa (more details), 2.1 Å
SCOP Domain Sequences for d1cwaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cwaa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]} mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
Timeline for d1cwaa_: