SCOPe 2.07: Domain d4qnja2: 4qnj A:96-193

Lineage for d4qnja2 (4qnj A:96-193)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.9: Imidazole glycerol phosphate dehydratase [102766] (2 proteins)
   duplication; there are two structural repeats of this fold

6. Protein automated matches [254526] (2 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [255158] (11 PDB entries)

8. Domain d4qnja2: 4qnj A:96-193 [274252]
   Other proteins in same PDB: d4qnja1
   automated match to d4mu3a2
   complexed with cl, fmt, mn, trs

Details for d4qnja2

PDB Entry: 4qnj, 1.3 Å

PDB Description: the structure of wt a. thaliana igpd2 in complex with mn2+ and formate at 1.3a resolution

PDB Compounds: (A:) Imidazoleglycerol-phosphate dehydratase 2, chloroplastic

SCOPe Domain Sequences for d4qnja2:

Sequence; same for both SEQRES and ATOM records:

>d4qnja2 d.14.1.9 (A:96-193) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ginrfgdftapldealihvsldlsgrpylgynleiptqrvgtydtqlvehffqslvntsg
mtlhirqlagknshhiieatfkafaralrqatesdprr

Timeline for d4qnja2:

• d4qnja2 first appeared in SCOPe 2.05
  
• d4qnja2 appears in SCOPe 2.06
  
• d4qnja2 appears in the current release, SCOPe 2.08