Class b: All beta proteins [48724] (180 folds) |
Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.2: beta-Barrel protease inhibitors [50882] (3 families) |
Family b.61.2.1: Metalloprotease inhibitor [50883] (1 protein) automatically mapped to Pfam PF02974 |
Protein Metalloprotease inhibitor [50884] (2 species) |
Species Erwinia chrysanthemi [TaxId:556] [50885] (1 PDB entry) |
Domain d1smpi_: 1smp I: [27417] Other proteins in same PDB: d1smpa1, d1smpa2 complexed with ca, zn |
PDB Entry: 1smp (more details), 2.3 Å
SCOPe Domain Sequences for d1smpi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1smpi_ b.61.2.1 (I:) Metalloprotease inhibitor {Erwinia chrysanthemi [TaxId: 556]} sslrlpsaaelsgqwvlsgaeqhcdirlntdvldgttwklagdtaclqkllpeapvgwrp tpdgltltqadgsavaffsrnrdryehklvdgsvrtlkkk
Timeline for d1smpi_: