Lineage for d4zrib3 (4zri B:215-311)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2412582Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2412583Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2413229Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2413230Protein automated matches [190052] (8 species)
    not a true protein
  7. 2413308Species Human (Homo sapiens) [TaxId:9606] [186914] (120 PDB entries)
  8. 2413439Domain d4zrib3: 4zri B:215-311 [274139]
    Other proteins in same PDB: d4zria1, d4zria2, d4zrib1, d4zrib2
    automated match to d1h4ra2

Details for d4zrib3

PDB Entry: 4zri (more details), 2.7 Å

PDB Description: crystal structure of merlin-ferm and lats2
PDB Compounds: (B:) merlin

SCOPe Domain Sequences for d4zrib3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zrib3 b.55.1.0 (B:215-311) automated matches {Human (Homo sapiens) [TaxId: 9606]}
emygvnyfairnkkgtelllgvdalglhiydpenrltpkisfpwneirnisysdkeftik
pldkkidvfkfnssklrvnklilqlcignhdlfmrrr

SCOPe Domain Coordinates for d4zrib3:

Click to download the PDB-style file with coordinates for d4zrib3.
(The format of our PDB-style files is described here.)

Timeline for d4zrib3: