Class b: All beta proteins [48724] (178 folds) |
Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.0: automated matches [191311] (1 protein) not a true family |
Protein automated matches [190052] (8 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186914] (120 PDB entries) |
Domain d4zrib3: 4zri B:215-311 [274139] Other proteins in same PDB: d4zria1, d4zria2, d4zrib1, d4zrib2 automated match to d1h4ra2 |
PDB Entry: 4zri (more details), 2.7 Å
SCOPe Domain Sequences for d4zrib3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zrib3 b.55.1.0 (B:215-311) automated matches {Human (Homo sapiens) [TaxId: 9606]} emygvnyfairnkkgtelllgvdalglhiydpenrltpkisfpwneirnisysdkeftik pldkkidvfkfnssklrvnklilqlcignhdlfmrrr
Timeline for d4zrib3: