![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
![]() | Protein automated matches [190144] (14 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries) |
![]() | Domain d4y8rv_: 4y8r V: [273969] Other proteins in same PDB: d4y8ra_, d4y8re_, d4y8rg_, d4y8ri_, d4y8rj_, d4y8rk_, d4y8rl_, d4y8rn_, d4y8ro_, d4y8rs_, d4y8ru_, d4y8rw_, d4y8rx_, d4y8ry_, d4y8rz_ automated match to d4r17h_ complexed with cl, mes, mg; mutant |
PDB Entry: 4y8r (more details), 2.7 Å
SCOPe Domain Sequences for d4y8rv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y8rv_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihadgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee
Timeline for d4y8rv_: