SCOP 1.59: Domain d1swfb_: 1swf B:

Lineage for d1swfb_ (1swf B:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.61: Streptavidin-like [50875] (4 superfamilies)

4. Superfamily b.61.1: Avidin/streptavidin [50876] (1 family)

5. Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (85 PDB entries)

8. Domain d1swfb_: 1swf B: [27392]

Details for d1swfb_

PDB Entry: 1swf, 2 Å

PDB Description: circular permuted streptavidin e51/a46

SCOP Domain Sequences for d1swfb_:

Sequence; same for both SEQRES and ATOM records:

>d1swfb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii}
sryvltgrydsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwllt
sgtteanawkstlvghdtftkvkpsaasgggsaeagitgtwynqlgstfivtagadgalt
gtyes

Timeline for d1swfb_:

• d1swfb_ first appeared (with stable ids) in SCOP 1.55
  
• d1swfb_ appears in SCOP 1.57
  
• d1swfb_ appears in SCOP 1.61
  
• d1swfb_ appears in the current release, SCOPe 2.08